• Gene id: 65979

Gene Summary

• Gene Symbol: PHACTR4   Gene   UCSC   Ensembl
• Aliases: PPP1R124
• Gene name: phosphatase and actin regulator 4
• Alternate names: phosphatase and actin regulator 4, protein phosphatase 1, regulatory subunit 124,
• Gene location: 1p35.3 (28369739: 28500363)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the phosphatase and actin regulator (PHACTR) family. Other PHACTR family members have been shown to inhibit protein phosphatase 1 (PP1) activity, and the homolog of this gene in the mouse has been shown to interact with actin

Protein Summary

• Protein general information: Q8IZ21  
  • Name: Phosphatase and actin regulator 4
  • Length: 702  
  • Mass: 78211
• Sequence:

  MEDPFEEADQPTTEPGMVLDSVEAGDTTPPTKRKSKFSGFGKIFKPWKWRKKKSSDKFKETSEVLERKISMRKPR
  EELVKRGVLLEDPEQGGEDPGKPSDAMLKNGHTTPIGNARSSSPVQVEEEPVRLASLRKAIPEEDLKKRLGSTGS
  QPNSEAESVPENVPKPPLLPPKRPLSSSHEASEGQAKDATSSGGTARFIISTSITTAPAATTAATSLAKTVNLSV
  TPSPAPRTLPAAPASTNTTATPSLTHMVPAKQPPIPPPKPAHRNSNPVIAELSQAINSGTLLSKPSPPLPPKRGI
  PSTSVPTLESAAAITTKTPSDEREKSTCSMGSELLPMISPRSPSPPLPTHIPPEPPRTPPFPAKTFQVVPEIEFP
  PSLDLHQEIPQQEDQKKEVPKRILDQNFGEPHIPSRLPPLPLHIRIQQALTSPLPMTPILEGSHRAHSLLFENSD
  SFSEDSSTLGRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYR
  DEEDEDESYQSALANKVKRKDTLAMKLNHRPSEPELNLNSWPCKSKEEWNEIRHQIGNTLIRRLSQRPTPEELEQ
  RNILQPKNEADRQAEKREIKRRLTRKLSQRPTVAELLARKILRFNEYVEVTDAQDYDRRADKPWTKLTPADKAAI
  RKELNEFKSSEMEVHEESKHFTRYHRP

• Structural information:
  • Interpro: IPR029984  IPR004018  
  • Prosite: PS51073
  • DIP: 47323
  • STRING: ENSP00000362942
• Other Databases: GeneCards:  PHACTR4  Malacards:  PHACTR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001755	neural crest cell migration	IBA	biological process
GO:0003779	actin binding	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:2001045	negative regulation of integrin-mediated signaling pathway	ISS	biological process
GO:0072542	protein phosphatase activator activity	ISS	molecular function
GO:0061386	closure of optic fissure	ISS	biological process
GO:0051726	regulation of cell cycle	ISS	biological process
GO:0030036	actin cytoskeleton organization	ISS	biological process
GO:0008157	protein phosphatase 1 binding	ISS	molecular function
GO:0007266	Rho protein signal transduction	ISS	biological process
GO:0003779	actin binding	ISS	molecular function
GO:0048484	enteric nervous system development	ISS	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0001843	neural tube closure	ISS	biological process
GO:0001755	neural crest cell migration	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0048484	enteric nervous system development	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0001755	neural crest cell migration	IEA	biological process
GO:2001045	negative regulation of integrin-mediated signaling pathway	IEA	biological process
GO:0072542	protein phosphatase activator activity	IEA	molecular function
GO:0061386	closure of optic fissure	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881