• Gene id: 654429

Gene Summary

• Gene Symbol: LRTM2   Gene   UCSC   Ensembl
• Gene name: leucine rich repeats and transmembrane domains 2
• Alternate names: leucine-rich repeat and transmembrane domain-containing protein 2,
• Gene location: 12p13.33 (1820266: 1836752)     Exons: 5     NC_000012.12

Protein Summary

• Protein general information: Q8N967  
  • Name: Leucine rich repeat and transmembrane domain containing protein 2
  • Length: 370  
  • Mass: 41158
• Sequence:

  MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAATRTLLL
  LNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSPLLRHLDLSIN
  GLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFKHWMEWFSYRGGRLDQ
  LACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKPGAEPEPEPSTACPQKQRHR
  PASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQPLMGDPEGEHEDQKQISSVA

• Structural information:
  • Protein Domains: (36..6-)
    (/note="LRRNT-)
    (198..25-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000446278
• Other Databases: GeneCards:  LRTM2  Malacards:  LRTM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007411	axon guidance	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0048495	Roundabout binding	IBA	molecular function
GO:0050919	negative chemotaxis	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq