|
Gene id |
653784 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
MZT2A Gene UCSC Ensembl |
|
Aliases |
FAM128A, MOZART2A |
|
Gene name |
mitotic spindle organizing protein 2A |
|
Alternate names |
mitotic-spindle organizing protein 2A, family with sequence similarity 128, member A, mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A, |
|
Gene location |
2q21.1 (131493079: 131469723) Exons: 9 NC_000002.12
|
|
OMIM |
613449 |
Protein Summary
|
| Protein general information
| Q6P582
Name: Mitotic spindle organizing protein 2A (Mitotic spindle organizing protein associated with a ring of gamma tubulin 2A)
Length: 158 Mass: 16221
|
| Sequence |
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQM LKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPG KSPTQGST
|
| Structural information |
|
| Other Databases |
GeneCards: MZT2A  Malacards: MZT2A |
|
|
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|