• Gene id: 6518

Gene Summary

• Gene Symbol: SLC2A5   Gene   UCSC   Ensembl
• Aliases: GLUT-5, GLUT5
• Gene name: solute carrier family 2 member 5
• Alternate names: solute carrier family 2, facilitated glucose transporter member 5, glucose transporter type 5, small intestine, glucose transporter-like protein 5, solute carrier family 2 (facilitated glucose/fructose transporter), member 5, testicular tissue protein Li 81,
• Gene location: 1p36.23 (9072258: 9035105)     Exons: 13     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a fructose transporter responsible for fructose uptake by the small intestine. The encoded protein also is necessary for the increase in blood pressure due to high dietary fructose consumption. [provided by RefSeq, Jun
• OMIM: 138230

Protein Summary

• Protein general information: P22732  
  • Name: Solute carrier family 2, facilitated glucose transporter member 5 (Fructose transporter) (Glucose transporter type 5, small intestine) (GLUT 5)
  • Length: 501  
  • Mass: 54974
  • Tissue specificity: Detected in skeletal muscle, and in jejunum brush border membrane and basolateral membrane (at protein level) (PubMed
• Sequence:

  MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTV
  SMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVPMYL
  GELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKK
  DEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA
  DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLTAALALQDTVSWMPYI
  SIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHWLSNFTVGLIFPFIQEGLGPYSFIVFAVICL
  LTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ

• Structural information:
  • Interpro: IPR002442  IPR020846  IPR005828  IPR036259  IPR003663   IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • PDB: 1YG1
  • PDBsum: 1YG1
  • STRING: ENSP00000366641
• Other Databases: GeneCards:  SLC2A5  Malacards:  SLC2A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015755	fructose transmembrane transport	IBA	biological process
GO:0005353	fructose transmembrane transporter activity	IBA	molecular function
GO:1990539	fructose import across plasma membrane	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005353	fructose transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005353	fructose transmembrane transporter activity	IDA	molecular function
GO:0015755	fructose transmembrane transport	IDA	biological process
GO:0009750	response to fructose	ISS	biological process
GO:0071332	cellular response to fructose stimulus	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0042383	sarcolemma	ISS	cellular component
GO:0003044	regulation of systemic arterial blood pressure mediated by a chemical signal	ISS	biological process
GO:0070061	fructose binding	ISS	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005353	fructose transmembrane transporter activity	IEA	molecular function
GO:0015755	fructose transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005353	fructose transmembrane transporter activity	TAS	molecular function
GO:0005355	glucose transmembrane transporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0015755	fructose transmembrane transport	TAS	biological process
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0005353	fructose transmembrane transporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0106001	intestinal hexose absorption	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009750	response to fructose	IEA	biological process
GO:1990539	fructose import across plasma membrane	IEA	biological process
GO:0003044	regulation of systemic arterial blood pressure mediated by a chemical signal	IEA	biological process
GO:0005353	fructose transmembrane transporter activity	IEA	molecular function
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0071332	cellular response to fructose stimulus	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04973	Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R