• Gene id: 6515

Gene Summary

• Gene Symbol: SLC2A3   Gene   UCSC   Ensembl
• Aliases: GLUT3
• Gene name: solute carrier family 2 member 3
• Alternate names: solute carrier family 2, facilitated glucose transporter member 3, GLUT-3, glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3,
• Gene location: 12p13.31 (62673877: 63046486)     Exons: 30     NC_000002.12
• OMIM: 138170

Protein Summary

• Protein general information: P11169  
  • Name: Solute carrier family 2, facilitated glucose transporter member 3 (Glucose transporter type 3, brain) (GLUT 3)
  • Length: 496  
  • Mass: 53924
  • Tissue specificity: Highly expressed in brain. Expressed in many tissues. {ECO
• Sequence:

  MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGM
  IGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTAL
  RGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQI
  LQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG
  VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVA
  FFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKV
  PETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV

• Structural information:
  • Interpro: IPR002945  IPR020846  IPR005828  IPR036259  IPR003663   IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • PDB: 4ZW9 4ZWB 4ZWC 5C65
  • PDBsum: 4ZW9 4ZWB 4ZWC 5C65
  • STRING: ENSP00000075120
• Other Databases: GeneCards:  SLC2A3  Malacards:  SLC2A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098708	glucose import across plasma membrane	IGI	biological process
GO:0150104	transport across blood-brain barrier	IGI	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005536	glucose binding	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005355	glucose transmembrane transporter activity	IDA	molecular function
GO:1904659	glucose transmembrane transport	IDA	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005355	glucose transmembrane transporter activity	TAS	molecular function
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005975	carbohydrate metabolic process	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0019852	L-ascorbic acid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Alzheimer's disease	PMID:8179300
Acanthosis nigricans	PMID:11436180
diabetes mellitus	PMID:10086067
type 2 diabetes mellitus	PMID:19110659
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray