• Gene id: 65012

Gene Summary

• Gene Symbol: SLC26A10   Gene   UCSC   Ensembl
• Gene name: solute carrier family 26 member 10
• Gene location: 12q13.3 (57619909: 57626150)     Exons: 14     NC_000012.12
• OMIM: 106195

Protein Summary

• Protein general information: Q8NG04  
  • Name: Solute carrier family 26 member 10
  • Length: 563  
  • Mass: 60059
• Sequence:

  MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASVPPVFGLYTSFFPVLIYSLLGTGRHL
  STGTFAILSLMTGSAVERLVPEPLVGNLSGIEKEQLDAQRVGVAAAVAFGSGALMLGMFVLQLGVLSTFLSEPVV
  KALTSGAALHVLLSQLPSLLGLSLPRQIGCFSLFKTLASLLTALPRSSPAELTISALSLALLVPVKELNVRFRDR
  LPTPIPGEVVLVLLASVLCFTSSVDTRYQVQIVGLLPGGFPQPLLPNLAELPRILADSLPIALVSFAVSASLASI
  HADKYSYTIDSNQEFLAHGASNLISSLFSCFPNSATLATTNLLVDAGGKTQLAGLFSCTVVLSVLLWLGPFFYYL
  PKAVLACINISSMRQVFCQMQELPQLWHISRVDFLLQVPGLCILSYPTPLYFGTRGQFRCNLEWHLGLGEGEKET
  SKPDGPMVAVAEPVRVVVLDFSGVTFADAAGAREVVQVRERLASRCRDARIRLLLAQCNALVQGTLTRVGLLDRV
  TPDQLFVSVQDAAAYALGSLLRGSSTRSGSQEALGCGK

• Structural information:
  • Protein Domains: (406..54-)
    (/note="STAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00198"-)
  • Interpro: IPR011547  IPR001902  IPR030324  IPR002645  IPR036513  
  • Prosite: PS50801
  • STRING: ENSP00000320217
• Other Databases: GeneCards:  SLC26A10  Malacards:  SLC26A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019531	oxalate transmembrane transporter activity	IBA	molecular function
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0015301	anion:anion antiporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0015108	chloride transmembrane transporter activity	IBA	molecular function
GO:0015106	bicarbonate transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015116	sulfate transmembrane transporter activity	IEA	molecular function
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0015701	bicarbonate transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0019532	oxalate transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq