• Gene id: 65008

Gene Summary

• Gene Symbol: MRPL1   Gene   UCSC   Ensembl
• Aliases: BM022, L1MT, MRP-L1
• Gene name: mitochondrial ribosomal protein L1
• Alternate names: 39S ribosomal protein L1, mitochondrial, mitochondrial large ribosomal subunit protein uL1m,
• Gene location: 4q21.1 (77862679: 77952789)     Exons: 10     NC_000004.12
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611743

Protein Summary

• Protein general information: Q9BYD6  
  • Name: 39S ribosomal protein L1, mitochondrial (L1mt) (MRP L1) (Mitochondrial large ribosomal subunit protein uL1m)
  • Length: 325  
  • Mass: 36909
• Sequence:

  MAAAVRCMGRALIHHQRHSLSKMVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEKTPDEKKDEIEKIKAY
  PYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPF
  ASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNS
  IGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTS
  EGLLLKIDPLLPKEVKNEESEKEDA

• Structural information:
  • Interpro: IPR023674  IPR028364  IPR016095  IPR005879  
  • CDD: cd00403
  • STRING: ENSP00000315017
• Other Databases: GeneCards:  MRPL1  Malacards:  MRPL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030686	90S preribosome	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0000470	maturation of LSU-rRNA	IBA	biological process
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0015934	large ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881