• Gene id: 64855

Gene Summary

• Gene Symbol: NIBAN2   Gene   UCSC   Ensembl
• Aliases: C9orf88, FAM129B, MEG-3, MINERVA, OC58, bA356B19.6
• Gene name: niban apoptosis regulator 2
• Alternate names: protein Niban 2, family with sequence similarity 129 member B, melanoma invasion by ERK, niban-like protein 1,
• Gene location: 9q34.11 (127579030: 127505338)     Exons: 17     NC_000009.12

Protein Summary

• Protein general information: Q96TA1  
  • Name: Protein Niban 2 (Meg 3) (Melanoma invasion by ERK) (MINERVA) (Niban like protein 1) (Protein FAM129B)
  • Length: 746  
  • Mass: 84138
• Sequence:

  MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNL
  FQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAP
  ILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGT
  WEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPA
  MQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTEVRDVFFKEVTDMNLN
  VINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFET
  LLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSELPRFQELIFE
  DFARFILVENTYEEVVLQTVMKDILQAVKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSNSGGGG
  SPSPSTPESATLSEKRRRAKQVVSVVQDEEVGLPFEASPESPPPASPDGVTEIRGLLAQGLRPESPPPAGPLLNG
  APAGESPQPKAAPEASSPPASPLQHLLPGKAVDLGPPKPSDQETGEQVSSPSSHPALHTTTEDSAGVQTEF

• Structural information:
  • Protein Domains: (68..19-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR026088  IPR011993  IPR001849  
  • Prosite: PS50003
  • STRING: ENSP00000362409
• Other Databases: GeneCards:  NIBAN2  Malacards:  NIBAN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005912	adherens junction	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	NOT|cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:2000279	negative regulation of DNA biosynthetic process	IDA	biological process
GO:2000279	negative regulation of DNA biosynthetic process	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:2000279	negative regulation of DNA biosynthetic process	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IDA	biological process
GO:0044029	hypomethylation of CpG island	ISS	biological process
GO:0032274	gonadotropin secretion	IEP	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0032274	gonadotropin secretion	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048743	positive regulation of skeletal muscle fiber development	ISS	biological process
GO:0016525	negative regulation of angiogenesis	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0030154	cell differentiation	ISS	biological process
GO:0045746	negative regulation of Notch signaling pathway	ISS	biological process
GO:0040019	positive regulation of embryonic development	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R