• Gene id: 64798

Gene Summary

• Gene Symbol: DEPTOR   Gene   UCSC   Ensembl
• Aliases: DEP.6, DEPDC6
• Gene name: DEP domain containing MTOR interacting protein
• Alternate names: DEP domain-containing mTOR-interacting protein, DEP domain containing 6, DEP domain-containing protein 6,
• Gene location: 8q24.12 (119873654: 120050917)     Exons: 9     NC_000008.11
• OMIM: 123690

Protein Summary

• Protein general information: Q8TB45  
  • Name: DEP domain containing mTOR interacting protein (DEP domain containing protein 6)
  • Length: 409  
  • Mass: 46294
• Sequence:

  MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIE
  HKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTL
  LQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMNFRRRR
  RLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
  PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGPAAAAGMKVCQFVVSV
  NGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC

• Structural information:
  • Protein Domains: (36..11-)
    (/note="DEP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066-)
    (145..21-)
    (/note="DEP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066-)
    (330..40-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR000591  IPR037589  IPR037335  IPR037336  IPR001478   IPR036034  IPR036388  IPR036390  
  • Prosite: PS50186 PS50106
  • CDD: cd04442 cd04441
  • STRING: ENSP00000286234
• Other Databases: GeneCards:  DEPTOR  Malacards:  DEPTOR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0032007	negative regulation of TOR signaling	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032007	negative regulation of TOR signaling	IMP	biological process
GO:0045792	negative regulation of cell size	IMP	biological process
GO:2001236	regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0006469	negative regulation of protein kinase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0032007	negative regulation of TOR signaling	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032007	negative regulation of TOR signaling	IMP	biological process
GO:0045792	negative regulation of cell size	IMP	biological process
GO:2001236	regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0006469	negative regulation of protein kinase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq