• Gene id: 64783

Gene Summary

• Gene Symbol: RBM15   Gene   UCSC   Ensembl
• Aliases: OTT, OTT1, SPEN
• Gene name: RNA binding motif protein 15
• Alternate names: RNA-binding protein 15, one twenty two protein, one twenty-two, one-twenty two protein 1, putative RNA-binding protein 15,
• Gene location: 1p13.3 (110339322: 110346680)     Exons: 3     NC_000001.11
• Gene summary(Entrez): Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM, Feb
• OMIM: 606077

Protein Summary

• Protein general information: Q96T37  
  • Name: RNA binding protein 15 (One twenty two protein 1) (RNA binding motif protein 15)
  • Length: 977  
  • Mass: 107189
• Sequence:

  MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRGGEDSTSRGERSKKLG
  GSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSSSRLHSYSSPSTKNSSGGGESRSSSRGGGGE
  SRSSGAASSAPGGGDGAEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRP
  EDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAAL
  GYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRT
  LFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGK
  ATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVD
  FADTEHRYQQQYLQPLPLTHYELVTDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRT
  AATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESDRPRKRHCAPSPDRSP
  ELSSSRDRYNSDNDRSSRLLLERPSPIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSD
  GSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGK
  VAQLKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQA
  AGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQIGVRYENKKRENLALT
  LL

• Structural information:
  • Protein Domains: (170..25-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (374..45-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (455..52-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (-)
  • Interpro: IPR012677  IPR035979  IPR034470  IPR034472  IPR034473   IPR000504  IPR016194  IPR012921  IPR010912  
  • Prosite: PS50102 PS50917
  • CDD: cd12553 cd12555 cd12557
  • STRING: ENSP00000358799
• Other Databases: GeneCards:  RBM15  Malacards:  RBM15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045652	regulation of megakaryocyte differentiation	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0001510	RNA methylation	IDA	biological process
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0009048	dosage compensation by inactivation of X chromosome	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	NOT|biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0016607	nuclear speck	IDA	cellular component
GO:0038163	thrombopoietin-mediated signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060674	placenta blood vessel development	IEA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	IEA	biological process
GO:0007221	positive regulation of transcription of Notch receptor target	IEA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IEA	biological process
GO:0060412	ventricular septum morphogenesis	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)