• Gene id: 64762

Gene Summary

• Gene Symbol: GAREM1   Gene   UCSC   Ensembl
• Aliases: C18orf11, FAM59A, GAREM, Gm944
• Gene name: GRB2 associated regulator of MAPK1 subtype 1
• Alternate names: GRB2-associated and regulator of MAPK protein 1, GRB2 associated regulator of MAPK1 1, GRB2 associated, regulator of MAPK1, GRB2-associated and regulator of MAPK1, Grb2-associated and regulator of Erk/MAPK, family with sequence similarity 59, member A, protein ,
• Gene location: 18q12.1 (32470881: 32263520)     Exons: 9     NC_000018.10
• Gene summary(Entrez): This gene encodes an adaptor protein which functions in the epidermal growth factor (EGF) receptor-mediated signaling pathway. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• OMIM: 608920

Protein Summary

• Protein general information: Q9H706  
  • Name: GRB2 associated and regulator of MAPK protein 1 (GRB2 associated and regulator of MAPK1)
  • Length: 876  
  • Mass: 97186
  • Tissue specificity: Isoform 1 is ubiquitously expressed. {ECO
• Sequence:

  MDPAPSLGCSLKDVKWSSVAVPLDLLVSTYRLPQIARLDNGECVEGLRENDYLLIHSCRQWTTITAHSLEEGHYV
  IGPKIEIPVHYAGQFKLLEQDRDIKEPVQYFNSVEEVAKAFPERVYVMEDITFNVKVASGECNEDTEVYNITLCT
  GDELTLMGQAEILYAKTFKEKSRLNTIFKKIGKLNSISKLGKGKMPCLICMNHRTNESISLPFQCKGRFSTRSPL
  ELQMQEGEHTIRNIVEKTRLPVNVTVPSPPPRNPYDLHFIREGHRYKFVNIQTKTVVVCCVLRNNKILPMHFPLH
  LTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKGRCSGHNHVPNSLSYA
  RDELTQSFHRLSVCVYGNNLHGNSEVNLHGCRDLGGDWAPFPHDILPYQDSGDSGSDYLFPEASEESAGIPGKSE
  LPYEELWLEEGKPSHQPLTRSLSEKNRCDQFRGSVRSKCATSPLPIPGTLGAAVKSSDTALPPPPVPPKSEAVRE
  ECRLLNAPPVPPRSAKPLSTSPSIPPRTVKPARQQTRSPSPTLSYYSSGLHNISVTKTDTNPSESTPVSCYPCNR
  VKTDSVDLKSPFGSPSAEAVSSRLSWPNHYSGASESQTRSDFLLDPSRSYSYPRQKTPGTPKRNCPAPFDFDGCE
  LLASPTSPVTAEFSSSVSGCPKSASYSLESTDVKSLAAGVTKQSTSCPALPPRAPKLVEEKVASETSPLPLKIDG
  AEEDPKSGSPDLSEDQYFVKKGMQDIFSASYPFSSPLHLQLAPRSCGDGSPWQPPADLSGLSIEEVSKSLRFIGL
  SEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGWRPKI

• Structural information:
  • Protein Domains: (811..87-)
    (/note="SAM"-)
  • Interpro: IPR025946  IPR013761  
  • PDB: 2DKZ
  • PDBsum: 2DKZ
  • STRING: ENSP00000269209
• Other Databases: GeneCards:  GAREM1  Malacards:  GAREM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007173	epidermal growth factor receptor signaling pathway	IBA	biological process
GO:0070064	proline-rich region binding	IBA	molecular function
GO:0071364	cellular response to epidermal growth factor stimulus	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:0070064	proline-rich region binding	IDA	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0005886	plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray