• Gene id: 646627

Gene Summary

• Gene Symbol: LYPD8   Gene   UCSC   Ensembl
• Gene name: LY6/PLAUR domain containing 8
• Alternate names: ly6/PLAUR domain-containing protein 8, phospholipase inhibitor,
• Gene location: 1q44 (248755786: 248739414)     Exons: 7     NC_000001.11

Protein Summary

• Protein general information: Q6UX82  
  • Name: Ly6/PLAUR domain containing protein 8
  • Length: 237  
  • Mass: 25265
  • Tissue specificity: Expressed in the large intestine. Preferentially expressed on the epithelial layer exposed to the lumen (at protein level). {ECO
• Sequence:

  MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETPVRLYQNMFCSAENCS
  EETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVSSNAECPACYESNGTSCHGKPWKCYEEEQCV
  FLVAELKNDIESKSLVLKGCSNVSNATCQFLSGENKTLGGVIFRKFECANVNSLTPTSAPTTSHNVGSKASLYLL
  ALASLLLRGLLP

• Structural information:
  • Protein Domains: (125..17-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR016054  
  • STRING: ENSP00000466070
• Other Databases: GeneCards:  LYPD8  Malacards:  LYPD8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0050829	defense response to Gram-negative bacterium	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R