• Gene id: 64579

Gene Summary

• Gene Symbol: NDST4   Gene   UCSC   Ensembl
• Aliases: N-HSST, N-HSST 4, NDST-4, NHSST4
• Gene name: N-deacetylase and N-sulfotransferase 4
• Alternate names: bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, glucosaminyl N-deacetylase/N-sulfotransferase 4,
• Gene location: 4q26 (34546822: 34560344)     Exons: 7     NC_000020.11
• OMIM: 615039

Protein Summary

• Protein general information: Q9H3R1  
  • Name: Bifunctional heparan sulfate N deacetylase/N sulfotransferase 4 (EC 2.8.2.8) (Glucosaminyl N deacetylase/N sulfotransferase 4) (NDST 4) (N heparan sulfate sulfotransferase 4) (N HSST 4) [Includes: Heparan sulfate N deacetylase 4 (EC 3. . . ); Heparan sulf
  • Length: 872  
  • Mass: 100716
• Sequence:

  MNLIVKLRRSFRTLIVLLATFCLVSIVISAYFLYSGYKQEMTLIETTAEAECTDIKILPYRSMELKTVKPIDTSK
  TDPTVLLFVESQYSQLGQDIIAILESSRFQYHMVIAPGKGDIPPLTDNGKGKYTLVIYENILKYVSMDSWNRELL
  EKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGPLPGEDWTIFQY
  NHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLSL
  DRYILVDIDDIFVGKEGTRMNVKDVKALLETQNLLRTQVANFTFNLGFSGKFYHTGTEEEDEGDDLLLRSVDEFW
  WFPHMWSHMQPHLFHNESSLVEQMILNKEFALEHGIPINMGYAVAPHHSGVYPVHIQLYAAWKKVWGIQVTSTEE
  YPHLKPARYRKGFIHNSIMVLPRQTCGLFTHTIFYKEYPGGPQELDKSIRGGELFLTILLNPISIFMTHLSNYGN
  DRLGLYTFVNLVNFVQSWTNLKLQTLPPVQLAHQYFELFPEQKDPLWQNPCDDKRHKDIWSREKTCDHLPKFLVI
  GPQKTGTTALYLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTSDFLFEKSANYFHSEE
  APRRAASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAALRFNFYEVISTGHWAPSDLKTLQRRCLVPGWYAVH
  IERWLTYFATSQLLIIDGQQLRSDPATVMDEVQKFLGVTPRYNYSEALTFDPQKGFWCQLLEGGKTKCLGKSKGR
  KYPPMDPESRTFLSNYYRDHNVELSKLLHRLGQPLPSWLRQELQKVR

• Structural information:
  • Interpro: IPR021930  IPR037359  IPR027417  IPR000863  
  • STRING: ENSP00000264363
• Other Databases: GeneCards:  NDST4  Malacards:  NDST4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IBA	biological process
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IBA	molecular function
GO:0019213	deacetylase activity	IBA	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0019213	deacetylase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IEA	biological process
GO:0030210	heparin biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq