• Gene id: 645745

Gene Summary

• Gene Symbol: MT1HL1   Gene   UCSC   Ensembl
• Aliases: MT1P2
• Gene name: metallothionein 1H like 1
• Alternate names: metallothionein 1H-like protein 1, MT-1H-like protein,
• Gene location: 1q43 (237004440: 237004102)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene is a retrotransposed gene, compared to MT1H (GeneID:4496). This retrogene is transcribed. It retains a full-length CDS, and is assumed to be translated. Compared to the MT1H product, this protein product differs at three internal amino acids, tw
• OMIM: 0

Protein Summary

• Protein general information: P0DM35  
  • Name: Metallothionein 1H like protein 1
  • Length: 61  
  • Mass: 6094
• Sequence:

  MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCCA

• Structural information:
  • Interpro: IPR003019  IPR017854  IPR023587  IPR000006  IPR001368  
  • STRING: ENSP00000476141
• Other Databases: GeneCards:  MT1HL1  Malacards:  MT1HL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071294	cellular response to zinc ion	IBA	biological process
GO:0071280	cellular response to copper ion	IBA	biological process
GO:0071276	cellular response to cadmium ion	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0046872	metal ion binding	IBA	molecular function
GO:0010273	detoxification of copper ion	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)