• Gene id: 645191

Gene Summary

• Gene Symbol: LINGO3   Gene   UCSC   Ensembl
• Aliases: LERN2, LRRN6B
• Gene name: leucine rich repeat and Ig domain containing 3
• Alternate names: leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, leucine rich repeat neuronal 6B, leucine-rich repeat neuronal protein 2, leucine-rich repeat neuronal protein 6B,
• Gene location: 19p13.3 (2308153: 2289783)     Exons: 2     NC_000019.10
• OMIM: 612064

Protein Summary

• Protein general information: P0C6S8  
  • Name: Leucine rich repeat and immunoglobulin like domain containing nogo receptor interacting protein 3 (Leucine rich repeat neuronal protein 2) (Leucine rich repeat neuronal protein 6B)
  • Length: 592  
  • Mass: 64881
• Sequence:

  MTCWLCVLSLPLLLLPAAPPPAGGCPARCECTVQTRAVACTRRRLTAVPDGIPAETRLLELSRNRIRCLNPGDLA
  ALPALEELDLSENAIAHVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLH
  SLRRLEVGDNDLVFVSRRAFAGLLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGLL
  HLEIDNWPLLEEVAAGSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELH
  LAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGR
  LPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCRAEGEPAPTVAWVTPQHRPVT
  ATSAGRARVLPGGTLEIQDARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLT
  TILVSTAMGCITFLGVVLFCFVLLFVWSRGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI

• Structural information:
  • Protein Domains: (25..5-)
    (/note="LRRNT-)
    (352..40-)
    (/note="LRRCT-)
    (407..49-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000467753
• Other Databases: GeneCards:  LINGO3  Malacards:  LINGO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray