• Gene id: 64410

Gene Summary

• Gene Symbol: KLHL25   Gene   UCSC   Ensembl
• Aliases: ENC-2, ENC2
• Gene name: kelch like family member 25
• Alternate names: kelch-like protein 25, BTB/POZ KELCH domain protein, ectoderm-neural cortex protein 2, ectodermal-neural cortex 2, kelch-like 25,
• Gene location: 15q25.3 (85794924: 85759325)     Exons: 3     NC_000015.10

Protein Summary

• Protein general information: Q9H0H3  
  • Name: Kelch like protein 25 (Ectoderm neural cortex protein 2) (ENC 2)
  • Length: 589  
  • Mass: 65923
• Sequence:

  MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMF
  SHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCL
  GMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPR
  KVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCARPRKAGHTLLIL
  GGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPML
  IARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWMMVAPLRDGVSNAAVVSAKLKLFVFG
  GTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMT
  AKRMSCHALASGNKLYVVGGYFGTQRCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA

• Structural information:
  • Protein Domains: (46..11-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037-)
    (149..25-)
    (/note="BACK"-)
  • Interpro: IPR011705  IPR017096  IPR000210  IPR015915  IPR006652   IPR030565  IPR011333  
  • Prosite: PS50097
  • STRING: ENSP00000336800
• Other Databases: GeneCards:  KLHL25  Malacards:  KLHL25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031463	Cul3-RING ubiquitin ligase complex	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0006446	regulation of translational initiation	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0006446	regulation of translational initiation	IEA	biological process
GO:0031463	Cul3-RING ubiquitin ligase complex	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq