• Gene id: 6441

Gene Summary

• Gene Symbol: SFTPD   Gene   UCSC   Ensembl
• Aliases: COLEC7, PSP-D, SFTP4, SP-D
• Gene name: surfactant protein D
• Alternate names: pulmonary surfactant-associated protein D, collectin-7, lung surfactant protein D, pulmonary surfactant apoprotein, surfactant-associated protein, pulmonary 4,
• Gene location: 10q22.3 (79982235: 79937739)     Exons: 9     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism. [provided by RefSeq, Jul 2015]
• OMIM: 609925

Protein Summary

• Protein general information: P35247  
  • Name: Pulmonary surfactant associated protein D (PSP D) (SP D) (Collectin 7) (Lung surfactant protein D)
  • Length: 375  
  • Mass: 37728
  • Tissue specificity: Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes). {ECO
• Sequence:

  MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQA
  GMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAP
  GMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVA
  SLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAAL
  QQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

• Structural information:
  • Protein Domains: (46..22-)
    (/note="Collagen-like-)
    (260..37-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR008160  IPR033990   IPR016187  IPR015097  
  • Prosite: PS00615 PS50041
  • CDD: cd03591
  • PDB: 1B08 1M7L 1PW9 1PWB 2GGU 2GGX 2ORJ 2ORK 2OS9 2RIA 2RIB 2RIC 2RID 2RIE 3DBZ 3G81 3G83 3G84 3IKN 3IKP 3IKQ 3IKR 4E52 4M17 4M18 5OXR 5OXS
  • PDBsum: 1B08 1M7L 1PW9 1PWB 2GGU 2GGX 2ORJ 2ORK 2OS9 2RIA 2RIB 2RIC 2RID 2RIE 3DBZ 3G81 3G83 3G84 3IKN 3IKP 3IKQ 3IKR 4E52 4M17 4M18 5OXR 5OXS
  • STRING: ENSP00000361366
• Other Databases: GeneCards:  SFTPD  Malacards:  SFTPD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005771	multivesicular body	IBA	cellular component
GO:0005791	rough endoplasmic reticulum	IBA	cellular component
GO:0043129	surfactant homeostasis	IBA	biological process
GO:0050766	positive regulation of phagocytosis	IBA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007585	respiratory gaseous exchange by respiratory system	IEA	biological process
GO:0005581	collagen trimer	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905226	regulation of adhesion of symbiont to host epithelial cell	IDA	biological process
GO:0052405	negative regulation by host of symbiont molecular function	IDA	biological process
GO:0043152	induction of bacterial agglutination	IMP	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0045334	clathrin-coated endocytic vesicle	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0072593	reactive oxygen species metabolic process	TAS	biological process
GO:0050766	positive regulation of phagocytosis	TAS	biological process
GO:0048286	lung alveolus development	IMP	biological process
GO:0045085	negative regulation of interleukin-2 biosynthetic process	TAS	biological process
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0030139	endocytic vesicle	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0048246	macrophage chemotaxis	TAS	biological process
GO:0043129	surfactant homeostasis	IMP	biological process
GO:0042130	negative regulation of T cell proliferation	TAS	biological process
GO:0005764	lysosome	TAS	cellular component
GO:0001817	regulation of cytokine production	NAS	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome

Diseases

Associated diseases	References
Pre-malignant neoplasm	PMID:18779194
Sarcoidosis	PMID:20151281
Adult respiratory distress syndrome	PMID:10588595
pulmonary alveolar proteinosis	PMID:19046553
pulmonary alveolar proteinosis	PMID:16849999
newborn respiratory distress syndrome	PMID:17524024
Cystic fibrosis	PMID:18211966
Bronchiolitis obliterans	PMID:18347569
Asthma	PMID:18266831
Asthma	PMID:16839409
Interstitial lung disease	PMID:19286849
Chronic obstructive pulmonary disease	PMID:20075511
Chronic obstructive pulmonary disease	PMID:20448057
lung non-small cell carcinoma	PMID:20401612
Lung disease	PMID:20435656
Lung disease	PMID:17974096
Systemic lupus erythematosus	PMID:19833760
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881