• Gene id: 64407

Gene Summary

• Gene Symbol: RGS18   Gene   UCSC   Ensembl
• Aliases: RGS13
• Gene name: regulator of G protein signaling 18
• Alternate names: regulator of G-protein signaling 18, regulator of G-protein signalling 13, regulator of G-protein signalling 18,
• Gene location: 1q31.2 (192158461: 192187171)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G a
• OMIM: 612428

Protein Summary

• Protein general information: Q9NS28  
  • Name: Regulator of G protein signaling 18 (RGS18)
  • Length: 235  
  • Mass: 27582
  • Tissue specificity: Expressed in peripheral leukocytes, bone marrow, platelet, spleen and fetal liver. {ECO
• Sequence:

  METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRV
  SPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKE
  VNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQ
  DVQSDVAIWL

• Structural information:
  • Protein Domains: (86..20-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR034950  IPR036305  IPR024066  
  • Prosite: PS50132
  • PDB: 2DLV 2JM5 2OWI
  • PDBsum: 2DLV 2JM5 2OWI
  • DIP: 59096
  • STRING: ENSP00000356430
• Other Databases: GeneCards:  RGS18  Malacards:  RGS18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881