• Gene id: 64386

Gene Summary

• Gene Symbol: MMP25   Gene   UCSC   Ensembl
• Aliases: MMP-25, MMP20, MMP20A, MMPL1, MT-MMP 6, MT-MMP6, MT6-MMP, MT6MMP, MTMMP6
• Gene name: matrix metallopeptidase 25
• Alternate names: matrix metalloproteinase-25, leukolysin, matrix metallopeptidase-like 1, matrix metalloproteinase 20, matrix metalloproteinase-like 1, membrane-type 6 matrix metalloproteinase, membrane-type matrix metalloproteinase 6,
• Gene location: 16p13.3 (3045962: 3060728)     Exons: 14     NC_000016.10
• Gene summary(Entrez): Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
• OMIM: 608482

Protein Summary

• Protein general information: Q9NPA2  
  • Name: Matrix metalloproteinase 25 (MMP 25) (EC 3.4.24. ) (Leukolysin) (Membrane type matrix metalloproteinase 6) (MT MMP 6) (MTMMP6) (Membrane type 6 matrix metalloproteinase) (MT6 MMP) (MT6MMP)
  • Length: 562  
  • Mass: 62554
  • Tissue specificity: Expressed predominantly in leukocytes, lung and spleen. Expressed also in colon carcinoma, astrocytoma and glioblastomas.
• Sequence:

  MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETG
  RMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWG
  MESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGT
  DLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
  PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYA
  RHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGY
  PRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATP
  VSETCDCQCELNQAAGRWPAPIPLLLLPLLVGGVASR

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR033739  IPR024079   IPR028733  IPR001818  IPR021190  IPR006026  IPR002477  
  • Prosite: PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000337816
• Other Databases: GeneCards:  MMP25  Malacards:  MMP25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060022	hard palate development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	NAS	biological process
GO:0006508	proteolysis	NAS	biological process
GO:0031012	extracellular matrix	NAS	cellular component
GO:0016020	membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04928	Parathyroid hormone synthesis, secretion and action

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq