• Gene id: 643236

Gene Summary

• Gene Symbol: TMEM72   Gene   UCSC   Ensembl
• Aliases: C10orf127, KSP37
• Gene name: transmembrane protein 72
• Alternate names: transmembrane protein 72, kidney-specific secretory protein of 37 kDa,
• Gene location: 10q11.21 (44911306: 44937009)     Exons: 8     NC_000010.11
• Gene summary(Entrez): This gene encodes a transmembrane protein which may be expressed specifically in the kidney. [provided by RefSeq, Sep 2016]
• OMIM: 0

Protein Summary

• Protein general information: A0PK05  
  • Name: Transmembrane protein 72 (Kidney specific secretory protein of 37 kDa)
  • Length: 275  
  • Mass: 29891
• Sequence:

  MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGS
  LADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYT
  DPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFE
  DNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF

• Structural information:
  • Interpro: IPR032055  
  • STRING: ENSP00000374234
• Other Databases: GeneCards:  TMEM72  Malacards:  TMEM72

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)