• Gene id: 64288

Gene Summary

• Gene Symbol: ZSCAN31   Gene   UCSC   Ensembl
• Aliases: ZNF20-Lp, ZNF310P, ZNF323
• Gene name: zinc finger and SCAN domain containing 31
• Alternate names: zinc finger and SCAN domain-containing protein 31, zinc finger protein 323,
• Gene location: 6p22.3-p22.1 (28359156: 28324736)     Exons: 14     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• OMIM: 610794

Protein Summary

• Protein general information: Q96LW9  
  • Name: Zinc finger and SCAN domain containing protein 31 (Zinc finger protein 323)
  • Length: 406  
  • Mass: 47293
  • Tissue specificity: Expressed at high levels in the lung, liver, and kidney, while weakly expressed in intestine, brain, muscle, cholecyst, heart, and pancreas. {ECO
• Sequence:

  MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRLRELCHQWLRPEIHTK
  EQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQ
  EPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSK
  AEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKEC
  GKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTG
  EKPYQCSQCSKLFSKRTLLKKHQKIHTGERP

• Structural information:
  • Protein Domains: (39..12-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • STRING: ENSP00000390076
• Other Databases: GeneCards:  ZSCAN31  Malacards:  ZSCAN31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray