Search Result
| Gene id | 64231 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | MS4A6A Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | 4SPAN3, 4SPAN3.2, CD20L3, CDA01, MS4A6, MST090, MSTP090 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | membrane spanning 4-domains A6A | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | membrane-spanning 4-domains subfamily A member 6A, CD20 antigen-like 3, CD20-like precusor, HAIRB-iso, MS4A6A-polymorph, four-span transmembrane protein 3, four-span transmembrane protein 3.1, four-span transmembrane protein 3.2, membrane-spanning 4-domains, subf, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
11q12.2 (60184665: 60171606) Exons: 12 NC_000011.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 603302 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9H2W1 Name: Membrane spanning 4 domains subfamily A member 6A (CD20 antigen like 3) (Four span transmembrane protein 3) Length: 248 Mass: 26943 Tissue specificity: Variable expression in some B-cell, myelomonocytic, and erythroleukemia cell lines. | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNF TQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCE LDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGTLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHS YIGNSGMSSKMTHDCGYEELLTS | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: MS4A6A  Malacards: MS4A6A | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||