• Gene id: 641649

Gene Summary

• Gene Symbol: TMEM91   Gene   UCSC   Ensembl
• Aliases: DSPC3, IFITMD6
• Gene name: transmembrane protein 91
• Alternate names: transmembrane protein 91, dispanin subfamily C member 3, interferon induced transmembrane protein domain containing 6,
• Gene location: 19q13.2 (41363946: 41384082)     Exons: 7     NC_000019.10

Protein Summary

• Protein general information: Q6ZNR0  
  • Name: Transmembrane protein 91 (Dispanin subfamily C member 3) (DSPC3)
  • Length: 172  
  • Mass: 18162
• Sequence:

  MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSS
  DSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRAFLLGVLAVGL
  GVCTYAAALVTLAAYLASRDPP

• Structural information:
  • Interpro: IPR007593  
  • STRING: ENSP00000375859
• Other Databases: GeneCards:  TMEM91  Malacards:  TMEM91

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq