• Gene id: 64146

Gene Summary

• Gene Symbol: PDF   Gene   UCSC   Ensembl
• Gene name: peptide deformylase, mitochondrial
• Alternate names: peptide deformylase, mitochondrial, peptide deformylase-like protein, polypeptide deformylase,
• Gene location: 16q22.1 (69330587: 69326912)     Exons: 2     NC_000016.10
• Gene summary(Entrez): Protein synthesis proceeds after formylation of methionine by methionyl-tRNA formyl transferase (FMT) and transfer of the charged initiator f-met tRNA to the ribosome. In eubacteria and eukaryotic organelles the product of this gene, peptide deformylase (
• OMIM: 176878

Protein Summary

• Protein general information: Q9HBH1  
  • Name: Peptide deformylase, mitochondrial (EC 3.5.1.88) (Polypeptide deformylase)
  • Length: 243  
  • Mass: 27013
  • Tissue specificity: Ubiquitous.
• Sequence:

  MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVL
  RGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPL
  RVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFI
  DKMDSRTFTNVYWMKVND

• Structural information:
  • Interpro: IPR023635  IPR036821  
  • CDD: cd00487
  • PDB: 3G5K 3G5P
  • PDBsum: 3G5K 3G5P
  • STRING: ENSP00000288022
• Other Databases: GeneCards:  PDF  Malacards:  PDF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0042586	peptide deformylase activity	IDA	molecular function
GO:0018206	peptidyl-methionine modification	IDA	biological process
GO:0031365	N-terminal protein amino acid modification	IDA	biological process
GO:0031365	N-terminal protein amino acid modification	IBA	biological process
GO:0043686	co-translational protein modification	IBA	biological process
GO:0042586	peptide deformylase activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0042586	peptide deformylase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray