Search Result
| Gene id | 64110 | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
| Gene Symbol | MAGEF1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||
| Aliases | MAGE-F1 | ||||||||||||||||||||||||||||
| Gene name | MAGE family member F1 | ||||||||||||||||||||||||||||
| Alternate names | melanoma-associated antigen F1, MAGE-F1 antigen, melanoma antigen family F, 1, melanoma antigen family F1, | ||||||||||||||||||||||||||||
| Gene location |
3q27.1 (184712063: 184710363) Exons: 1 NC_000003.12 |
||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. [provided by RefSeq, Jul 2008] |
||||||||||||||||||||||||||||
| OMIM | 609267 | ||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
| Protein general information | Q9HAY2 Name: Melanoma associated antigen F1 (MAGE F1) (MAGE F1 antigen) Length: 307 Mass: 35222 Tissue specificity: Ubiquitous. {ECO | ||||||||||||||||||||||||||||
| Sequence |
MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARRRAYRR LNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLK PLEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLS YRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASA RAGIHLW | ||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||
| Other Databases | GeneCards: MAGEF1  Malacards: MAGEF1 | ||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||