• Gene id: 64109

Gene Summary

• Gene Symbol: CRLF2   Gene   UCSC   Ensembl
• Aliases: CRL2, CRLF2Y, TSLPR
• Gene name: cytokine receptor like factor 2
• Alternate names: cytokine receptor-like factor 2, IL-XR, TSLP receptor, cytokine receptor CRL2 precusor, thymic stromal lymphopoietin protein receptor, thymic stromal-derived lymphopoietin receptor,
• Gene location: Xp22.33 and Yp11.2 (1212761: 1190436)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pat
• OMIM: 300357400023

Protein Summary

• Protein general information: Q9HC73  
  • Name: Cytokine receptor like factor 2 (Cytokine receptor like 2) (IL XR) (Thymic stromal lymphopoietin protein receptor) (TSLP receptor)
  • Length: 371  
  • Mass: 42013
  • Tissue specificity: Expressed in heart, skeletal muscle, kidney and adult and fetal liver. Primarily expressed in dendrites and monocytes. Weakly expressed in T-cells.
• Sequence:

  MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYL
  LQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEV
  QYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPP
  KPKLSKFILISSLAILLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA
  GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFTFVMNDRSYVAL

• Structural information:
  • Protein Domains: (118..21-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • PDB: 5J11 5J12
  • PDBsum: 5J11 5J12
  • STRING: ENSP00000383641
• Other Databases: GeneCards:  CRLF2  Malacards:  CRLF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0019955	cytokine binding	IBA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019976	interleukin-2 binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0004896	cytokine receptor activity	IDA	molecular function
GO:1904894	positive regulation of receptor signaling pathway via STAT	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:2000664	positive regulation of interleukin-5 secretion	IMP	biological process
GO:0004896	cytokine receptor activity	IMP	molecular function
GO:0033005	positive regulation of mast cell activation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
B-cell acute lymphoblastic leukemia	KEGG:H00001
B-cell acute lymphoblastic leukemia	KEGG:H00001
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)