Search Result
| Gene id | 64063 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | PRSS22 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | BSSP-4, SP001LA, hBSSP-4 | ||||||||||||||||||||||||||||||||||||
| Gene name | serine protease 22 | ||||||||||||||||||||||||||||||||||||
| Alternate names | brain-specific serine protease 4, prosemin, protease, serine 22, protease, serine S1 family member 22, serine protease 26, tryptase epsilon, | ||||||||||||||||||||||||||||||||||||
| Gene location |
16p13.3 (2858629: 2852728) Exons: 7 NC_000016.10 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16. [provided by RefSeq, Jul 2008] |
||||||||||||||||||||||||||||||||||||
| OMIM | 609343 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q9GZN4 Name: Brain specific serine protease 4 (BSSP 4) (EC 3.4.21. ) (Serine protease 22) (Serine protease 26) (Tryptase epsilon) Length: 317 Mass: 33732 Tissue specificity: Expressed abundantly in the epithelial cells of the airways, including trachea, esophagus and fetal lung. Scarce in adult lung. Expressed at low levels in placenta, pancreas, prostate and thyroid gland. {ECO | ||||||||||||||||||||||||||||||||||||
| Sequence |
MVVSGAPPALGGGCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHC AGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERS IQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDM LCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQG GGALRAPSQGSGAAARS | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PRSS22  Malacards: PRSS22 | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||