• Gene id: 6397

Gene Summary

• Gene Symbol: SEC14L1   Gene   UCSC   Ensembl
• Aliases: PRELID4A, SEC14L
• Gene name: SEC14 like lipid binding 1
• Alternate names: SEC14-like protein 1,
• Gene location: 17q25.2-q25.3 (39391105: 39385628)     Exons: 15     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternativ
• OMIM: 601504

Protein Summary

• Protein general information: Q92503  
  • Name: SEC14 like protein 1
  • Length: 715  
  • Mass: 81250
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGV
  DYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPENEDWTCFEQSASLDIKSFFGFESTVEKIAMK
  QYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSP
  SAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
  SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGL
  RRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSP
  FIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIY
  QSASVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
  LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVI
  GSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISR

• Structural information:
  • Protein Domains: (1..17-)
    (/note="PRELI/MSF1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00158-)
    (319..49-)
    (/note="CRAL-TRIO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00056-)
    (521..67-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096-)
  • Interpro: IPR001251  IPR036865  IPR011074  IPR036273  IPR009038   IPR036598  IPR006797  
  • Prosite: PS50191 PS50866 PS50904
  • CDD: cd00170
  • STRING: ENSP00000376268
• Other Databases: GeneCards:  SEC14L1  Malacards:  SEC14L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015871	choline transport	IDA	biological process
GO:0005794	Golgi apparatus	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IC	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0039536	negative regulation of RIG-I signaling pathway	IMP	biological process
GO:0039552	RIG-I binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq