• Gene id: 6342

Gene Summary

• Gene Symbol: SCP2   Gene   UCSC   Ensembl
• Aliases: NLTP, NSL-TP, SCP-2, SCP-CHI, SCP-X, SCPX
• Gene name: sterol carrier protein 2
• Alternate names: non-specific lipid-transfer protein, epididymis secretory sperm binding protein, propanoyl-CoA C-acyltransferase, sterol carrier protein X,
• Gene location: 1p32.3 (15778327: 15853231)     Exons: 8     NC_000004.12
• Gene summary(Entrez): This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer S
• OMIM: 184755

Protein Summary

• Protein general information: P22307  
  • Name: Non specific lipid transfer protein (NSL TP) (EC 2.3.1.176) (Propanoyl CoA C acyltransferase) (SCP chi) (SCPX) (Sterol carrier protein 2) (SCP 2) (Sterol carrier protein X) (SCP X)
  • Length: 547  
  • Mass: 58994
  • Tissue specificity: Liver, fibroblasts, and placenta.
• Sequence:

  MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRA
  IYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINK
  YGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCC
  PTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDID
  VIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGE
  AGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQ
  FVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKI
  TGNMGLAMKLQNLQLQPGNAKL

• Structural information:
  • Protein Domains: (433..54-)
    (/note="SCP2"-)
  • Interpro: IPR003033  IPR036527  IPR016039  IPR020615  IPR020617   IPR020613  IPR020616  
  • Prosite: PS00098 PS00737
  • PDB: 1QND 2C0L
  • PDBsum: 1QND 2C0L
  • STRING: ENSP00000360569
• Other Databases: GeneCards:  SCP2  Malacards:  SCP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032934	sterol binding	IBA	molecular function
GO:0032385	positive regulation of intracellular cholesterol transport	IBA	biological process
GO:0015914	phospholipid transport	IBA	biological process
GO:0006694	steroid biosynthetic process	IBA	biological process
GO:0006635	fatty acid beta-oxidation	ISS	biological process
GO:0003988	acetyl-CoA C-acyltransferase activity	ISS	molecular function
GO:0008206	bile acid metabolic process	ISS	biological process
GO:0050633	acetyl-CoA C-myristoyltransferase activity	ISS	molecular function
GO:0016747	transferase activity, transferring acyl groups other than amino-acyl groups	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0033814	propanoyl-CoA C-acyltransferase activity	IEA	molecular function
GO:0050632	propionyl-CoA C2-trimethyltridecanoyltransferase activity	IEA	molecular function
GO:0050632	propionyl-CoA C2-trimethyltridecanoyltransferase activity	EXP	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0036109	alpha-linolenic acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	TAS	biological process
GO:0050632	propionyl-CoA C2-trimethyltridecanoyltransferase activity	TAS	molecular function
GO:0050632	propionyl-CoA C2-trimethyltridecanoyltransferase activity	TAS	molecular function
GO:0050632	propionyl-CoA C2-trimethyltridecanoyltransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007031	peroxisome organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032385	positive regulation of intracellular cholesterol transport	IDA	biological process
GO:0000062	fatty-acyl-CoA binding	IDA	molecular function
GO:1901373	lipid hydroperoxide transport	IDA	biological process
GO:0070538	oleic acid binding	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0036042	long-chain fatty acyl-CoA binding	IDA	molecular function
GO:0015485	cholesterol binding	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04146	Peroxisome
hsa03320	PPAR signaling pathway
hsa01212	Fatty acid metabolism
hsa01040	Biosynthesis of unsaturated fatty acids
hsa00120	Primary bile acid biosynthesis

Diseases

Associated diseases	References
Peroxisomal beta-oxidation enzyme deficiency	KEGG:H00407
Leukoencephalopathy with dystonia and motor neuropathy	KEGG:H00874
Peroxisomal beta-oxidation enzyme deficiency	KEGG:H00407
Leukoencephalopathy with dystonia and motor neuropathy	KEGG:H00874
Zellweger syndrome	PMID:3555624
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray