• Gene id: 6322

Gene Summary

• Gene Symbol: SCML1   Gene   UCSC   Ensembl
• Gene name: Scm polycomb group protein like 1
• Alternate names: sex comb on midleg-like protein 1, sex comb on midleg like 1,
• Gene location: Xp22.13 (32685187: 32773874)     Exons: 23     NC_000003.12
• OMIM: 300227

Protein Summary

• Protein general information: Q9UN30  
  • Name: Sex comb on midleg like protein 1
  • Length: 329  
  • Mass: 37447
  • Tissue specificity: Ubiquitous. Expressed in fetal and adult tissues. {ECO
• Sequence:

  MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNL
  DKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNS
  PSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYST
  DHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVL
  LKHLGVKLGTAVKLCYYIDRLKQGKCFEN

• Structural information:
  • Protein Domains: (258..32-)
    (/note="SAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00184"-)
  • Interpro: IPR001660  IPR013761  
  • Prosite: PS50105
  • STRING: ENSP00000369380
• Other Databases: GeneCards:  SCML1  Malacards:  SCML1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)