• Gene id: 6304

Gene Summary

• Gene Symbol: SATB1   Gene   UCSC   Ensembl
• Gene name: SATB homeobox 1
• Alternate names: DNA-binding protein SATB1, special AT-rich sequence binding protein 1 (binds to nuclear matrix/scaffold-associating DNA),
• Gene location: 3p24.3 (18445591: 18345376)     Exons: 11     NC_000003.12
• Gene summary(Entrez): This gene encodes a matrix protein which binds nuclear matrix and scaffold-associating DNAs through a unique nuclear architecture. The protein recruits chromatin-remodeling factors in order to regulate chromatin structure and gene expression. [provided by
• OMIM: 602075

Protein Summary

• Protein general information: Q01826  
  • Name: DNA binding protein SATB1 (Special AT rich sequence binding protein 1)
  • Length: 763  
  • Mass: 85957
  • Tissue specificity: Expressed predominantly in thymus. {ECO
• Sequence:

  MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRKGTMLP
  VFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPD
  ATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYY
  ANVSAAKCQEFGRWYKHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
  PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKPLEQQVSTNTEVSSEI
  YQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQSLLVNLRAMQNFLQLPEAERDRIYQDERER
  SLNAASAMGPAPLISTPPSRPPQVKTATIATERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQ
  GWLCELLRWKEDPSPENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
  QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAI
  QTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELS
  VEGNTDINTDLKD

• Structural information:
  • Interpro: IPR003350  IPR032355  IPR009057  IPR001356  IPR010982   IPR039673  IPR038216  IPR038224  IPR032392  
  • Prosite: PS51042 PS50071
  • CDD: cd00086 cd11585
  • PDB: 1YSE 2L1P 2MW8 2O49 2O4A 3NZL 3TUO
  • PDBsum: 1YSE 2L1P 2MW8 2O49 2O4A 3NZL 3TUO
  • DIP: 48757
  • STRING: ENSP00000399518
• Other Databases: GeneCards:  SATB1  Malacards:  SATB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006338	chromatin remodeling	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006338	chromatin remodeling	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003690	double-stranded DNA binding	TAS	molecular function
GO:0006325	chromatin organization	TAS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006338	chromatin remodeling	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0043374	CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0050798	activated T cell proliferation	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005720	nuclear heterochromatin	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0008544	epidermis development	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0016571	histone methylation	IEA	biological process
GO:0042110	T cell activation	IEA	biological process
GO:0043367	CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0060004	reflex	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)