• Gene id: 6296

Gene Summary

• Gene Symbol: ACSM3   Gene   UCSC   Ensembl
• Aliases: SA, SAH
• Gene name: acyl-CoA synthetase medium chain family member 3
• Alternate names: acyl-coenzyme A synthetase ACSM3, mitochondrial, SA (rat hypertension-associated) homolog, SA hypertension-associated homolog, butyrate--CoA ligase 3, butyryl-coenzyme A synthetase 3, middle-chain acyl-CoA synthetase 3, propionate--CoA ligase, protein SA homolog,
• Gene location: 16p12.3 (20742439: 20797810)     Exons: 19     NC_000016.10

Protein Summary

• Protein general information: Q53FZ2  
  • Name: Acyl coenzyme A synthetase ACSM3, mitochondrial (EC 6.2.1.2) (Acyl CoA synthetase medium chain family member 3) (Butyrate CoA ligase 3) (Butyryl coenzyme A synthetase 3) (Middle chain acyl CoA synthetase 3) (Propionate CoA ligase) (EC 6.2.1.17) (Protein
  • Length: 586  
  • Mass: 66153
• Sequence:

  MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAG
  KKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVACLRTGTVLIPG
  TTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTK
  HNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFT
  HHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDVTEKWRNKTGLDIYEG
  YGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPGQEGDIGIQVLPNRPFGLFTHYVDNPSKTAS
  TLRGNFYITGDRGYMDKDGYFWFVARADDVILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVV
  LNPDYKSHDQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEWKTI

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  
  • Prosite: PS00455
  • STRING: ENSP00000289416
• Other Databases: GeneCards:  ACSM3  Malacards:  ACSM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003996	acyl-CoA ligase activity	IBA	molecular function
GO:0006633	fatty acid biosynthetic process	IBA	biological process
GO:0015645	fatty acid ligase activity	IBA	molecular function
GO:0004321	fatty-acyl-CoA synthase activity	IBA	molecular function
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0006637	acyl-CoA metabolic process	IBA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0047760	butyrate-CoA ligase activity	IEA	molecular function
GO:0050218	propionate-CoA ligase activity	IEA	molecular function
GO:0047760	butyrate-CoA ligase activity	IEA	molecular function
GO:0015645	fatty acid ligase activity	IEA	molecular function
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0018729	propionate CoA-transferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0042632	cholesterol homeostasis	NAS	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008217	regulation of blood pressure	NAS	biological process
GO:0003996	acyl-CoA ligase activity	IBA	molecular function
GO:0006633	fatty acid biosynthetic process	IBA	biological process
GO:0015645	fatty acid ligase activity	IBA	molecular function
GO:0004321	fatty-acyl-CoA synthase activity	IBA	molecular function
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0006637	acyl-CoA metabolic process	IBA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0047760	butyrate-CoA ligase activity	IEA	molecular function
GO:0050218	propionate-CoA ligase activity	IEA	molecular function
GO:0047760	butyrate-CoA ligase activity	IEA	molecular function
GO:0015645	fatty acid ligase activity	IEA	molecular function
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0018729	propionate CoA-transferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0042632	cholesterol homeostasis	NAS	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008217	regulation of blood pressure	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00650	Butanoate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881