• Gene id: 6251

Gene Summary

• Gene Symbol: RSU1   Gene   UCSC   Ensembl
• Aliases: RSP-1
• Gene name: Ras suppressor protein 1
• Alternate names: ras suppressor protein 1, ras suppressor protein 1 variant 1, ras suppressor protein 1 variant 2, ras suppressor protein 1 variant 3, ras suppressor protein 1 variant 5, rsu-1,
• Gene location: 10p13 (16817453: 16590610)     Exons: 6     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initia
• OMIM: 179555

Protein Summary

• Protein general information: Q15404  
  • Name: Ras suppressor protein 1 (RSP 1) (Rsu 1)
  • Length: 277  
  • Mass: 31540
• Sequence:

  MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQI
  EELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILP
  PDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQ
  FQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR

• Structural information:
  • Interpro: IPR001611  IPR025875  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000367154
• Other Databases: GeneCards:  RSU1  Malacards:  RSU1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010811	positive regulation of cell-substrate adhesion	IMP	biological process
GO:0010810	regulation of cell-substrate adhesion	IMP	NOT|biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R