• Gene id: 6123

Gene Summary

• Gene Symbol: RPL3L   Gene   UCSC   Ensembl
• Gene name: ribosomal protein L3 like
• Alternate names: 60S ribosomal protein L3-like, large ribosomal subunit protein uL3-like,
• Gene location: 16p13.3 (23570247: 23676104)     Exons: 12     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein that shares sequence similarity with ribosomal protein L3. The protein belongs to the L3P family of ribosomal proteins. Unlike the ubiquitous expression of ribosomal protein genes, this gene has a tissue-specific pattern of exp
• OMIM: 617416

Protein Summary

• Protein general information: Q92901  
  • Name: 60S ribosomal protein L3 like (Large ribosomal subunit protein uL3 like)
  • Length: 407  
  • Mass: 46296
• Sequence:

  MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREVHRPGLKISKREEVEA
  VTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKDWHKSKKKAFTKACKRWRDTDGKKQLQKDF
  AAMKKYCKVIRVIVHTQMKLLPFRQKKAHIMEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKG
  RGVKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK
  NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAVENIELKFIDTTSKFG
  HGRFQTAQEKRAFMGPQKKHLEKETPETSGDL

• Structural information:
  • Interpro: IPR000597  IPR019926  IPR009000  
  • Prosite: PS00474
  • STRING: ENSP00000268661
• Other Databases: GeneCards:  RPL3L  Malacards:  RPL3L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0000027	ribosomal large subunit assembly	IBA	biological process
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0003735	structural constituent of ribosome	TAS	molecular function
GO:0005840	ribosome	TAS	cellular component
GO:0006412	translation	TAS	biological process
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0022625	cytosolic large ribosomal subunit	HDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray