• Gene id: 60626

Gene Summary

• Gene Symbol: RIC8A   Gene   UCSC   Ensembl
• Aliases: RIC8
• Gene name: RIC8 guanine nucleotide exchange factor A
• Alternate names: synembryn-A, resistance to inhibitors of cholinesterase 8 homolog A,
• Gene location: 11p15.5 (207510: 215174)     Exons: 10     NC_000011.10

Protein Summary

• Protein general information: Q9NPQ8  
  • Name: Synembryn A (Protein Ric 8A)
  • Length: 531  
  • Mass: 59710
• Sequence:

  MEPRAVAEAVETGEEDVIMEALRSYNQEHSQSFTFDDAQQEDRKRLAELLVSVLEQGLPPSHRVIWLQSVRILSR
  DRNCLDPFTSRQSLQALACYADISVSEGSVPESADMDVVLESLKCLCNLVLSSPVAQMLAAEARLVVKLTERVGL
  YRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLLTDTLELTLGVTPEGNPPPTLLPSQETERAMEIL
  KVLFNITLDSIKGEVDEEDAALYRHLGTLLRHCVMIATAGDRTEEFHGHAVNLLGNLPLKCLDVLLTLEPHGDST
  EFMGVNMDVIRALLIFLEKRLHKTHRLKESVAPVLSVLTECARMHRPARKFLKAQVLPPLRDVRTRPEVGEMLRN
  KLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAK
  ASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSD
  PDSDPD

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR019318  IPR008376  
  • STRING: ENSP00000325941
• Other Databases: GeneCards:  RIC8A  Malacards:  RIC8A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0001965	G-protein alpha-subunit binding	IBA	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001944	vasculature development	IEA	biological process
GO:0042074	cell migration involved in gastrulation	IEA	biological process
GO:0070586	cell-cell adhesion involved in gastrulation	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007369	gastrulation	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0071711	basement membrane organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray