|
Gene id |
605 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
BCL7A Gene UCSC Ensembl |
|
Aliases |
BCL7 |
|
Gene name |
BAF chromatin remodeling complex subunit BCL7A |
|
Alternate names |
B-cell CLL/lymphoma 7 protein family member A, B-cell CLL/lymphoma 7A, B-cell CLL/lymphoma-7, BCL tumor suppressor 7A, BCL7A, BAF complex component, |
|
Gene location |
12q24.31 (122021883: 122062043) Exons: 11 NC_000012.12
|
|
Gene summary(Entrez) |
This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the patho
|
|
OMIM |
601406 |
Protein Summary
|
| Protein general information
| Q4VC05
Name: B cell CLL/lymphoma 7 protein family member A
Length: 210 Mass: 22810
|
| Sequence |
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEV TTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASD EQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM
|
| Structural information |
|
| Other Databases |
GeneCards: BCL7A  Malacards: BCL7A |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005575 |
cellular_component
|
ND |
cellular component |
GO:0003674 |
molecular_function
|
ND |
molecular function |
GO:0045892 |
negative regulation of tr anscription, DNA-template d
|
NAS |
biological process |
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Cryptorchidism | MIK: 28606200 |
| Spermatogenic defects | MIK: 31037746 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
| 28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|