• Gene id: 60493

Gene Summary

• Gene Symbol: FASTKD5   Gene   UCSC   Ensembl
• Aliases: dJ1187M17.5
• Gene name: FAST kinase domains 5
• Alternate names: FAST kinase domain-containing protein 5, mitochondrial,
• Gene location: 20p13 (3159864: 3146518)     Exons: 2     NC_000020.11
• OMIM: 614272

Protein Summary

• Protein general information: Q7L8L6  
  • Name: FAST kinase domain containing protein 5, mitochondrial
  • Length: 764  
  • Mass: 86574
  • Tissue specificity: Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart, smooth muscle, liver and thyroid. {ECO
• Sequence:

  MAATLKSLKLVRYRAFCSPSAFGAVRSVSYWNVSSTQHGGQDPPEHISLCHSAKKVKNICSTFSSRRILTTSSAH
  PGLEFSKTSSSKASTLQLGSPRATGVDEEDVEVFDSFENMRVFLQLRPEYRVHSYNASETSQLLSVSEGELILHK
  VRVNQNNLQAQVIVDYLCKLSSLPAEQHPVLLGSTSFALLCQLSVKKIQLFDTQDLINVLKAFVILGIPHSHSML
  DVYETKCCHQVWEMNMDQLLLVADLWRYLGRKVPRFLNIFSSYLNLHWKDLSLSQLVHLIYVIGENRQVSQDLMQ
  KLESLILKYIDLINLEEVGTICLGFFKSSTNLSEFVMRKIGDLACANIQHLSSRSLVNIVKMFRFTHVDHINFMK
  QIGEIAPQRIPSLGVQGVMHLTLYCSALRFLNEGVMNAVAASLPPRVAHCRSKDVAKILWSFGTLNYKPPNAEEF
  YSSLISEIHRKMPEFNQYPEHLPTCLLGLAFLEYFPVELIDFALSPGFVRLAQERTKFDLLKELYTLDGTVGIEC
  PDYRGNRLSTHLQQEGSELLWYLAEKDMNSKPEFLETVFLLETMLGGPQYVKHHMILPHTRSSDLEVQLDVNLKP
  LPFNREATPAENVAKLRLEHVGVSLTDDLMNKLLKGKARGHFQGKTESEPGQQPMELENKAAVPLGGFLCNVADK
  SGAMEMAGLCPAACMQTPRMKLAVQFTNRNQYCYGSRDLLGLHNMKRRQLARLGYRVVELSYWEWLPLLKRTRLE
  KLAFLHEKVFTSAL

• Structural information:
  • Protein Domains: (697..75-)
    (/note="RAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00619"-)
  • Interpro: IPR013579  IPR010622  IPR013584  
  • Prosite: PS51286
  • STRING: ENSP00000369618
• Other Databases: GeneCards:  FASTKD5  Malacards:  FASTKD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019843	rRNA binding	IDA	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0035770	ribonucleoprotein granule	IDA	cellular component
GO:0000963	mitochondrial RNA processing	IMP	biological process
GO:0044528	regulation of mitochondrial mRNA stability	IEA	biological process
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0019843	rRNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq