• Gene id: 60488

Gene Summary

• Gene Symbol: MRPS35   Gene   UCSC   Ensembl
• Aliases: HDCMD11P, MDS023, MRP-S28, MRPS28
• Gene name: mitochondrial ribosomal protein S35
• Alternate names: 28S ribosomal protein S35, mitochondrial, 28S ribosomal protein S28, mitochondrial, MRP-S35, S28mt, S35mt, mitochondrial ribosomal protein S28, mitochondrial small ribosomal subunit protein mS35,
• Gene location: 12p11.22 (149551438: 149492981)     Exons: 11     NC_000005.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611995

Protein Summary

• Protein general information: P82673  
  • Name: 28S ribosomal protein S35, mitochondrial (MRP S35) (S35mt) (28S ribosomal protein S28, mitochondrial) (MRP S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35)
  • Length: 323  
  • Mass: 36844
• Sequence:

  MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAP
  FKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIE
  IDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYL
  LTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLK
  NEEENENSISQYKESVKRLLNVT

• Structural information:
  • Interpro: IPR039848  IPR019349  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000081029
• Other Databases: GeneCards:  MRPS35  Malacards:  MRPS35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0032543	mitochondrial translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0042769	DNA damage response, detection of DNA damage	NAS	biological process
GO:0005763	mitochondrial small ribosomal subunit	NAS	cellular component
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881