• Gene id: 5999

Gene Summary

• Gene Symbol: RGS4   Gene   UCSC   Ensembl
• Aliases: RGP4, SCZD9
• Gene name: regulator of G protein signaling 4
• Alternate names: regulator of G-protein signaling 4, schizophrenia disorder 9,
• Gene location: 1q23.3 (163068605: 163076801)     Exons: 7     NC_000001.11
• Gene summary(Entrez): Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph
• OMIM: 608144

Protein Summary

• Protein general information: P49798  
  • Name: Regulator of G protein signaling 4 (RGP4) (RGS4)
  • Length: 205  
  • Mass: 23256
  • Tissue specificity: Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum. {E
• Sequence:

  MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAA
  FKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFD
  EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

• Structural information:
  • Protein Domains: (62..17-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR034952  IPR034953  IPR036305  IPR024066  
  • Prosite: PS50132
  • CDD: cd08714
  • DIP: 59092
  • STRING: ENSP00000397181
• Other Databases: GeneCards:  RGS4  Malacards:  RGS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005516	calmodulin binding	TAS	molecular function
GO:0000188	inactivation of MAPK activity	TAS	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:1990791	dorsal root ganglion development	IEA	biological process
GO:1900924	negative regulation of glycine import across plasma membrane	IEA	biological process
GO:0060160	negative regulation of dopamine receptor signaling pathway	IEA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0001975	response to amphetamine	IEA	biological process
GO:1901380	negative regulation of potassium ion transmembrane transport	IEA	biological process
GO:1901379	regulation of potassium ion transmembrane transport	IEA	biological process
GO:0110053	regulation of actin filament organization	IEA	biological process
GO:0061052	negative regulation of cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R