• Gene id: 5973

Gene Summary

• Gene Symbol: RENBP   Gene   UCSC   Ensembl
• Aliases: RBP, RNBP
• Gene name: renin binding protein
• Alternate names: N-acylglucosamine 2-epimerase, AGE, GlcNAc 2-epimerase, N-acetyl-D-glucosamine 2-epimerase,
• Gene location: Xq28 (153944642: 153935262)     Exons: 11     NC_000023.11
• Gene summary(Entrez): The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze
• OMIM: 611703

Protein Summary

• Protein general information: P51606  
  • Name: N acylglucosamine 2 epimerase (AGE) (EC 5.1.3.8) (GlcNAc 2 epimerase) (N acetyl D glucosamine 2 epimerase) (Renin binding protein) (RnBP)
  • Length: 427  
  • Mass: 48831
• Sequence:

  MSKGLPARQDMEKERETLQAWKERVGQELDRVVAFWMEHSHDQEHGGFFTCLGREGRVYDDLKYVWLQGRQVWMY
  CRLYRTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKCAFVLTRDGRPVKVQRTIFSECFYTMAMNELWRATGE
  VRYQTEAVEMMDQIVHWVQEDASGLGRPQLQGAPAAEPMAVPMMLLNLVEQLGEADEELAGKYAELGDWCARRIL
  QHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHG
  GLFYFQDADNFCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSRE
  GKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSRPAPAPSPAPTPACRGAE

• Structural information:
  • Interpro: IPR008928  IPR012341  IPR034116  
  • CDD: cd00249
  • STRING: ENSP00000377303
• Other Databases: GeneCards:  RENBP  Malacards:  RENBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0030414	peptidase inhibitor activity	IBA	molecular function
GO:0050121	N-acylglucosamine 2-epimerase activity	IBA	molecular function
GO:0006051	N-acetylmannosamine metabolic process	IBA	biological process
GO:0019262	N-acetylneuraminate catabolic process	TAS	biological process
GO:0050121	N-acylglucosamine 2-epimerase activity	ISS	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0050121	N-acylglucosamine 2-epimerase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006048	UDP-N-acetylglucosamine biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IEA	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IEA	biological process
GO:0017076	purine nucleotide binding	IEA	molecular function
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0050121	N-acylglucosamine 2-epimerase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006051	N-acetylmannosamine metabolic process	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0050121	N-acylglucosamine 2-epimerase activity	IEA	molecular function
GO:0019262	N-acetylneuraminate catabolic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00520	Amino sugar and nucleotide sugar metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R