Search Result
| Gene id | 5939 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | RBMS2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | SCR3 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | RNA binding motif single stranded interacting protein 2 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | RNA-binding motif, single-stranded-interacting protein 2, suppressor of CDC2 with RNA-binding motif 3, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
12q13.3 (56520405: 56596192) Exons: 23 NC_000012.12 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 602387 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q15434 Name: RNA binding motif, single stranded interacting protein 2 (Suppressor of CDC2 with RNA binding motif 3) Length: 407 Mass: 43959 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSKTNLYIRGLQPGTTDQDLVKL CQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQE LEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPSDPLLCKFADGGPKKR QNQGKFVQNGRAWPRNADMGVMALTYDPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQ VPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAAAMQGAYISQYTPVPS SSVSVEESSGQQNQVAVDAPSEHGVYSFQFNK | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: RBMS2  Malacards: RBMS2 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||