• Gene id: 59342

Gene Summary

• Gene Symbol: SCPEP1   Gene   UCSC   Ensembl
• Aliases: HSCP1, RISC
• Gene name: serine carboxypeptidase 1
• Alternate names: retinoid-inducible serine carboxypeptidase, serine carboxypeptidase 1 precursor protein,
• Gene location: 17q22 (56978128: 57006767)     Exons: 7     NC_000017.11

Protein Summary

• Protein general information: Q9HB40  
  • Name: Retinoid inducible serine carboxypeptidase (EC 3.4.16. ) (Serine carboxypeptidase 1)
  • Length: 452  
  • Mass: 50831
• Sequence:

  MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATNSCKNFSELPLVMWLQ
  GGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGTGFSYVNGSGAYAKDLAMVASDMMVLLKTFF
  SCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKCNFAGVALGDSWISPVDSVLSWGPYLYSMSLLEDK
  GLAEVSKVAEQVLNAVNKGLYREATELWGKAEMIIEQNTDGVNFYNILTKSTPTSTMESSLEFTQSHLVCLCQRH
  VRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVISIVDELLEAGINVTVYNGQLDLIVD
  TMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQ
  QE

• Structural information:
  • Interpro: IPR029058  IPR001563  IPR018202  
  • Prosite: PS00131
  • STRING: ENSP00000262288
• Other Databases: GeneCards:  SCPEP1  Malacards:  SCPEP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051603	proteolysis involved in cellular protein catabolic process	IBA	biological process
GO:0004185	serine-type carboxypeptidase activity	IBA	molecular function
GO:0004185	serine-type carboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0097755	positive regulation of blood vessel diameter	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0004185	serine-type carboxypeptidase activity	IEA	molecular function
GO:0042573	retinoic acid metabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0042573	retinoic acid metabolic process	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0004185	serine-type carboxypeptidase activity	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0097755	positive regulation of blood vessel diameter	ISS	biological process
GO:0045776	negative regulation of blood pressure	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq