• Gene id: 59277

Gene Summary

• Gene Symbol: NTN4   Gene   UCSC   Ensembl
• Aliases: PRO3091
• Gene name: netrin 4
• Alternate names: netrin-4, beta-netrin, hepar-derived netrin-like protein,
• Gene location: 12q22 (95791154: 95657806)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the netrin family of proteins, which function in various biological processes including axon guidance, tumorogenesis, and angiogenesis. Netrins are laminin-related proteins that have an N-terminal laminin-type domain, epiderm
• OMIM: 610401

Protein Summary

• Protein general information: Q9HB63  
  • Name: Netrin 4 (Beta netrin) (Hepar derived netrin like protein)
  • Length: 628  
  • Mass: 70071
  • Tissue specificity: Expressed in kidney, spleen, mammary gland, aorta, heart, ovary, prostate and fetal spleen. {ECO
• Sequence:

  MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCRQP
  KCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
  GKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLR
  VQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
  GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCK
  PGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCD
  CAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYS
  YVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKL
  IVNMKSFVQHWKPSLGRKVMDILKRECK

• Structural information:
  • Protein Domains: (30..26-)
    (/note="Laminin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00466-)
    (262..33-)
    1 (/note="Laminin-EGF-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00460-)
    (332..39-)
    2 (/note="Laminin-EGF-like)
    (/evidence="ECO:-)
  • Interpro: IPR002049  IPR008211  IPR038684  IPR035811  IPR001134   IPR018933  IPR008993  
  • Prosite: PS00022 PS01248 PS50027 PS51117 PS50189
  • CDD: cd03578
  • DIP: 46274
  • STRING: ENSP00000340998
• Other Databases: GeneCards:  NTN4  Malacards:  NTN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009888	tissue development	IBA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0043256	laminin complex	IBA	cellular component
GO:0070831	basement membrane assembly	IBA	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060668	regulation of branching involved in salivary gland morphogenesis by extracellular matrix-epithelial cell signaling	IEA	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0016322	neuron remodeling	IEA	biological process
GO:0043237	laminin-1 binding	IEA	molecular function
GO:0005604	basement membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)