• Gene id: 59271

Gene Summary

• Gene Symbol: EVA1C   Gene   UCSC   Ensembl
• Aliases: B18, B19, C21orf63, C21orf64, FAM176C, PRED34, SUE21
• Gene name: eva-1 homolog C
• Alternate names: protein eva-1 homolog C, family with sequence similarity 176, member C, protein FAM176C,
• Gene location: 21q22.11 (25819905: 25832941)     Exons: 9     NC_000001.11

Protein Summary

• Protein general information: P58658  
  • Name: Protein eva 1 homolog C (Protein FAM176C) (SUE21)
  • Length: 441  
  • Mass: 49483
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MLLPGRARQPPTPQPVQHPGLRRQVEPPGQLLRLFYCTVLVCSKEISALTDFSGYLTKLLQNHTTYACDGDYLNL
  QCPRHSTISVQSAFYGQDYQMCSSQKPASQREDSLTCVAATTFQKVLDECQNQRACHLLVNSRVFGPDLCPGSSK
  YLLVSFKCQPNELKNKTVCEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAERLPPFDCLSYSALQVLSRR
  CYGKQRCKIIVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLKQKDGEYGINFDPSGSKVLRK
  DGILVSNSLAAFAYIRAHPERAALLFVSSVCIGLALTLCALVIRESCAKDFRDLQLGREQLVPGSDKVEEDSEDE
  EEEEDPSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY

• Structural information:
  • Protein Domains: (67..15-)
    1 (/note="SUEL-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00260-)
    (168..26-)
    2 (/note="SUEL-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00260"-)
  • Interpro: IPR039500  IPR000922  
  • Prosite: PS50228
  • STRING: ENSP00000300255
• Other Databases: GeneCards:  EVA1C  Malacards:  EVA1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	colocalizes with
GO:0008201	heparin binding	IBA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IDA	colocalizes with
GO:0008201	heparin binding	IMP	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq