• Gene id: 5918

Gene Summary

• Gene Symbol: RARRES1   Gene   UCSC   Ensembl
• Aliases: LXNL, PERG-1, TIG1
• Gene name: retinoic acid receptor responder 1
• Alternate names: retinoic acid receptor responder protein 1, RAR-responsive protein TIG1, latexin-like, phorbol ester-induced gene 1 protein, retinoic acid receptor responder (tazarotene induced) 1, tazarotene-induced gene 1 protein,
• Gene location: 3q25.32 (158732943: 158696891)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be dow
• OMIM: 605090

Protein Summary

• Protein general information: P49788  
  • Name: Retinoic acid receptor responder protein 1 (Phorbol ester induced gene 1 protein) (PERG 1) (RAR responsive protein TIG1) (Tazarotene induced gene 1 protein)
  • Length: 294  
  • Mass: 33285
• Sequence:

  MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSG
  SPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIE
  KKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWK
  TNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF

• Structural information:
  • Interpro: IPR009684  IPR027261  
  • STRING: ENSP00000237696
• Other Databases: GeneCards:  RARRES1  Malacards:  RARRES1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008191	metalloendopeptidase inhibitor activity	IBA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)