• Gene id: 5917

Gene Summary

• Gene Symbol: RARS1   Gene   UCSC   Ensembl
• Aliases: ArgRS, DALRD1, HLD9, RARS
• Gene name: arginyl-tRNA synthetase 1
• Alternate names: arginine--tRNA ligase, cytoplasmic, arginine tRNA ligase 1, cytoplasmic, arginyl-tRNA synthetase, cytoplasmic,
• Gene location: 5q34 (1248551: 1259142)     Exons: 9     NC_000019.10
• Gene summary(Entrez): Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first prot
• OMIM: 107820

Protein Summary

• Protein general information: P54136  
  • Name: Arginine tRNA ligase, cytoplasmic (EC 6.1.1.19) (Arginyl tRNA synthetase) (ArgRS)
  • Length: 660  
  • Mass: 75379
• Sequence:

  MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMIN
  IISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNEC
  IEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLF
  EFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK
  NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDGRKIVFVPGCSIPLTI
  VKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAGFGVVLGEDKK
  KFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLD
  DRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY
  IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM

• Structural information:
  • Interpro: IPR001412  IPR001278  IPR005148  IPR036695  IPR035684   IPR008909  IPR014729  IPR009080  
  • Prosite: PS00178
  • CDD: cd00671
  • PDB: 4Q2T 4Q2X 4Q2Y 4R3Z 4ZAJ
  • PDBsum: 4Q2T 4Q2X 4Q2Y 4R3Z 4ZAJ
  • STRING: ENSP00000231572
• Other Databases: GeneCards:  RARS1  Malacards:  RARS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006420	arginyl-tRNA aminoacylation	IBA	biological process
GO:0004814	arginine-tRNA ligase activity	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IDA	cellular component
GO:0004814	arginine-tRNA ligase activity	IDA	molecular function
GO:0006420	arginyl-tRNA aminoacylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0004814	arginine-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006420	arginyl-tRNA aminoacylation	IEA	biological process
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006420	arginyl-tRNA aminoacylation	TAS	biological process
GO:0004814	arginine-tRNA ligase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0004814	arginine-tRNA ligase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006420	arginyl-tRNA aminoacylation	IEA	biological process
GO:0006420	arginyl-tRNA aminoacylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IEA	cellular component
GO:0004814	arginine-tRNA ligase activity	IEA	molecular function
GO:0034618	arginine binding	IEA	molecular function
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IEA	cellular component
GO:0004814	arginine-tRNA ligase activity	IEA	molecular function
GO:0000049	tRNA binding	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Hypomyelinating leukodystrophy	KEGG:H00679
Hypomyelinating leukodystrophy	KEGG:H00679
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881