• Gene id: 5900

Gene Summary

• Gene Symbol: RALGDS   Gene   UCSC   Ensembl
• Aliases: RGDS, RGF, RalGEF
• Gene name: ral guanine nucleotide dissociation stimulator
• Alternate names: ral guanine nucleotide dissociation stimulator, ral guanine nucleotide exchange factor,
• Gene location: 9q34.13-q34.2 (133149209: 133097721)     Exons: 21     NC_000009.12
• Gene summary(Entrez): Guanine nucleotide dissociation stimulators (GDSs, or exchange factors), such as RALGDS, are effectors of Ras-related GTPases (see MIM 190020) that participate in signaling for a variety of cellular processes.[supplied by OMIM, Nov 2010]
• OMIM: 177015

Protein Summary

• Protein general information: Q12967  
  • Name: Ral guanine nucleotide dissociation stimulator (RalGDS) (Ral guanine nucleotide exchange factor) (RalGEF)
  • Length: 914  
  • Mass: 100607
• Sequence:

  MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEELINGV
  IYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAF
  TTTQQVLDLLFKRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLV
  AYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPA
  PGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPSLQPSWPSPVVAENGL
  SEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLG
  NRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNY
  SLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFE
  VIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPS
  TELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETS
  GISSASSSTSSSSASTTPVAATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKA
  PAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLP
  RMKQKGLKIAKGIF

• Structural information:
  • Protein Domains: (112..24-)
    (/note="N-terminal-Ras-GEF)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00135-)
    (386..64-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (798..88-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSI-)
  • Interpro: IPR000159  IPR015758  IPR008937  IPR000651  IPR019804   IPR023578  IPR001895  IPR036964  IPR029071  
  • Prosite: PS50200 PS00720 PS50009 PS50212
  • CDD: cd00155 cd06224
  • PDB: 1RAX 2B3A 2RGF 3KH0
  • PDBsum: 1RAX 2B3A 2RGF 3KH0
  • DIP: 31375
  • STRING: ENSP00000361120
• Other Databases: GeneCards:  RALGDS  Malacards:  RALGDS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0030695	GTPase regulator activity	IDA	molecular function
GO:0005903	brush border	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030695	GTPase regulator activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa05231	Choline metabolism in cancer
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq