• Gene id: 58517

Gene Summary

• Gene Symbol: RBM25   Gene   UCSC   Ensembl
• Aliases: NET52, RED120, RNPC7, S164, Snu71, fSAP94
• Gene name: RNA binding motif protein 25
• Alternate names: RNA-binding protein 25, Arg/Glu/Asp-rich protein, 120 kDa, RNA-binding region (RNP1, RRM) containing 7, RNA-binding region-containing protein 7, U1 small nuclear ribonucleoprotein 1SNRP homolog, arg/Glu/Asp-rich protein of 120 kDa, functional spliceosome-associ,
• Gene location: 14q24.2 (73058531: 73123898)     Exons: 21     NC_000014.9
• OMIM: 612427

Protein Summary

• Protein general information: P49756  
  • Name: RNA binding protein 25 (Arg/Glu/Asp rich protein of 120 kDa) (RED120) (Protein S164) (RNA binding motif protein 25) (RNA binding region containing protein 7)
  • Length: 843  
  • Mass: 100185
• Sequence:

  MSFPPHLNRPPMGIPALPPGIPPPQFPGFPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLK
  AKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDL
  QIGEKKLLVKVDAKTKAQLDEWKAKKKASNGNARPETVTNDDEEALDEETKRRDQMIKGAIEVLIREYSSELNAP
  SQESDSHPRKKKKEKKEDIFRRFPVAPLIPYPLITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEK
  ERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSS
  DRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKL
  REKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDR
  EKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEP
  MEEEEEPEQKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGAS
  NSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKP
  ELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVK
  MWRLLIYETEAKKIGLVK

• Structural information:
  • Protein Domains: (87..16-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (750..84-)
    (/note="PWI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00627"-)
  • Interpro: IPR012677  IPR002483  IPR036483  IPR035979  IPR034268   IPR000504  
  • Prosite: PS51025 PS50102
  • CDD: cd12446
  • PDB: 3V53
  • PDBsum: 3V53
  • STRING: ENSP00000261973
• Other Databases: GeneCards:  RBM25  Malacards:  RBM25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)