Search Result
| Gene id | 58515 | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Diseases PubMed | |||||||||||||||||
Gene Summary |
|||||||||||||||||
| Gene Symbol | SELENOK Gene UCSC Ensembl | ||||||||||||||||
| Aliases | HSPC030, HSPC297, SELK | ||||||||||||||||
| Gene name | selenoprotein K | ||||||||||||||||
| Alternate names | selenoprotein K, | ||||||||||||||||
| Gene location |
3p21.1 (53891858: 53884416) Exons: 5 NC_000003.12 |
||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene belongs to the selenoprotein K family. It is a transmembrane protein that is localized in the endoplasmic reticulum (ER), and is involved in ER-associated degradation (ERAD) of misfolded, glycosylated proteins. It also has |
||||||||||||||||
| OMIM | 607916 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
| Protein general information | Q9Y6D0 Name: Selenoprotein K (SelK) Length: 94 Mass: 10645 Tissue specificity: Highly expressed in heart. {ECO | ||||||||||||||||
| Sequence |
MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMG RINHLRGPSPPPMAGGUGR | ||||||||||||||||
| Structural information |
| ||||||||||||||||
| Other Databases | GeneCards: SELENOK Malacards: SELENOK | ||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||
| |||||||||||||||||
PubMed references
|
|||||||||||||||||
| |||||||||||||||||