• Gene id: 58511

Gene Summary

• Gene Symbol: DNASE2B   Gene   UCSC   Ensembl
• Aliases: DLAD
• Gene name: deoxyribonuclease 2 beta
• Alternate names: deoxyribonuclease-2-beta, DNase II beta, DNase II-like acid DNase, DNase2-like acid DNase, deoxyribonuclease II beta, endonuclease DLAD, lysosomal DNase II,
• Gene location: 1p31.1-p22.3 (72446622: 72374592)     Exons: 4     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNa
• OMIM: 608057

Protein Summary

• Protein general information: Q8WZ79  
  • Name: Deoxyribonuclease 2 beta (EC 3.1.22.1) (DNase II like acid DNase) (DNase2 like acid DNase) (Deoxyribonuclease II beta) (DNase II beta) (Endonuclease DLAD)
  • Length: 361  
  • Mass: 41713
  • Tissue specificity: Highly expressed in the eye lens and in salivary gland. Detected at lower levels in lung, prostate and lymph node. Isoform 2 is lung specific. {ECO
• Sequence:

  MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRK
  SEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFWLIHSIPQFPP
  IPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMPQLCTRASSSEIPGRL
  LTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFS
  SYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK

• Structural information:
  • Interpro: IPR004947  
  • STRING: ENSP00000359699
• Other Databases: GeneCards:  DNASE2B  Malacards:  DNASE2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004531	deoxyribonuclease II activity	IBA	molecular function
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0004531	deoxyribonuclease II activity	IEA	molecular function
GO:0006259	DNA metabolic process	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0004519	endonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004531	deoxyribonuclease II activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004520	endodeoxyribonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)